Recombinant human GDF-15 (Qk017)

£180.00£2,400.00

Mature domain of recombinant human GDF15 protein (Uniprot: Q99988) expressed in E.coli.  High quality and purity with no contaminating TGF beta family growth factors.

SKU: Qk017_hGDF15 Categories: , Tags: , , ,

Description

Growth/differentiation factor 15 (GDF15) is a distant member of the TGFβ superfamily. Its expression is tightly regulated and circulating GDF15 in serum is associated with diseases such as cancer, cardiovascular disease, obesity and metabolic disease.

Unlike other members of the TGFβ superfamily that cause activation of the SMAD pathway, GDF15 signals through GRAL and co-receptor RET leading to RET phosphorylation and signalling through the ERK and AKT pathway (reviewed in Emmerson et al., 2018).  Commercial sources of GDF15, in particular those purified from mammalian expression are frequently contaminated with trace amounts of TGFβ and related proteins. These trace contaminants cause misleading experimental results due to the picomolar or even femtomolar EC50s of this family of cytokines (2).

We produce our proteins in E.coli with no animal products in our culture or purification processes to ensure there is no contamination from related proteins. In addition, we use a well-characterised SMAD2/3 activation assay to confirm there is no SMAD signalling.

Product: recombinant human GDF15 (Qk017)

Mature domain of human GDF15 (Uniprot: Q99988) expressed in E.coli and purified to homogeneity

Mature active protein is a disulphide-linked dimer in with a molecular weight of 25 kDa.

Protein is provided in lyophilised form without carrier protein.

Sequence:

MARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Alternative names:
Macrophage inhibitory cytokine 1 (MIC 1), NSAID activated gene 1 protein (NAG1)

Quality control:
We take the quality of our products very seriously, please see this blog by our founder, Marko Hyvonen to understand why we think improving growth factor quality will save valuable R&D time and expense. All our proteins are produced in-house by our scientists and we understand the potential impact on your work if your growth factors and cytokines are not consistent and of the highest quality.  We provide quality control data for each individual batch, please contact us any time if you have any questions.

The biochemical identity of each batch of human GDF15 is testing by SDS-PAGE and mass spec.  Correct recovery from the vial is checked to ensure you will get what you expect.

Endotoxin testing:
Stem cell cultures are sensitive to endotoxins, which can be present in media, serum and as a contaminants on plastic ware. We optimise our protein production processes to ensure the lowest possible levels of endotoxin contamination.  Endotoxin levels are determined by an external expert microbiological testing services provider and we set our endotoxin pass criteria at the industry leading <0.1 EU per ug protein and aim for <0.01 EU per ug protein.  We report the exact endotoxin levels for each batch.

hGDF15 batch #011 endotoxin level = <0.0005 EU/ug protein (below the detection level of the assay) 

Please see the datasheet for full batch-specific quality testing results, customer feedback and additional information.

Human recombinant GDF15 Qk017 batch #011 datasheet

Please contact us at orders@qkine.com for batch reservation, bulk purchasing arrangements or any other questions.

References:

1. Emmerson, P. J., Duffin, K. L., Chintharlapalli, S. & Wu, X. GDF15 and Growth Control. Front. Physiol. 9, 1712 (2018).
2. Olsen, O. E., Skjærvik, A., Størdal, B. F., Sundan, A. & Holien, T. TGF-β contamination of purified recombinant GDF15. PLoS One 12, e0187349 (2017).

Additional information

Unit size

1000 µg, 500 µg, 100 µg, 50 µg

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

You may also like…