FGF-2, basic FGF (zebrafish)

£250.00£400.00

Mature domain of zebrafish Danio rerio FGF2 (residues 2-154, Uniprot: B3DGE3) expressed in E.coli and purified to homogeneity as described in Ludwig et al. (2)
Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa.
Protein is provided in PBS without carrier protein at 10 mg/ml.

Sequence:
ATGGITTLPPAPDAENSSFPAGSFRDPKRLYCKNGGFFLRINADGRVDGARDKNDPHIRL
QLQATAVGEVLIKGICTNRFLAMNADGRLFGTKRTTDECYFLERLESNNYNTYRSRKYPD
WYVALKRTGQYKSGSKTSPGQKAILFLPMSAKC

SKU: Qk002_FGF2 Categories: , Tags: , , ,

Description

Fibroblast growth factor 2 (FGF2) or basic FGF has a broad range of physiological roles including regulation of cell proliferation and differentiation. FGF2 is used to support the maintenance of human embryonic stem cells and proliferation and differentiation of induced pluripotent and mesenchymal stem cells. FGF2 from zebrafish has been used extensively to support the maintenance of human stem cells. (1–3).

Product: recombinant FGF2, basic FGF

Mature domain of zebrafish Danio rerio FGF2 (residues 2-154, Uniprot: B3DGE3) expressed in E.coli and purified to homogeneity as described in Ludwig et al. (2)
Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa.
Protein is provided in PBS without carrier protein at 10mg/ml.

Sequence:
ATGGITTLPPAPDAENSSFPAGSFRDPKRLYCKNGGFFLRINADGRVDGARDKNDPHIRL
QLQATAVGEVLIKGICTNRFLAMNADGRLFGTKRTTDECYFLERLESNNYNTYRSRKYPD
WYVALKRTGQYKSGSKTSPGQKAILFLPMSAKC*

Alternative names:
Basic fibroblast growth factor, bFGF, FGF-β, FGF2, Fibroblast growth factor-basic, HBGF-2

References:
1. Ludwig, T. E. et al. Derivation of human embryonic stem cells in defined conditions. Nat. Biotechnol. 24, 185–187 (2006).
2. Ludwig, T. E. et al. Feeder-independent culture of human embryonic stem cells. Nat. Methods 3, 637–646 (2006).
3. Chen, G., Gulbranson, D. R., Yu, P., Hou, Z. & Thomson, J. A. Thermal stability of fibroblast growth factor protein is a determinant factor in regulating self-renewal, differentiation, and reprogramming in human pluripotent stem cells. Stem Cells 30, 623–30 (2012).

 

We take the quality of our products very seriously. All our proteins are produced in-house by our scientists and we understand the potential impact on your work if your growth factors and cytokines are not consistent and of the highest quality.  We provide quality control data for each individual batch, please contact us any time if you have any questions.

Qk002 FGF2 batch 010 datasheet

Additional information

Unit size

1000 µg, 500 µg, 100 µg, 50 µg

1 review for FGF-2, basic FGF (zebrafish)

  1. Catherine

    We have also used the FGF2 for pancreatic cancer sphere systems and it seems to support the growth of the cells as we would expect. University of Oxford, UK.

Only logged in customers who have purchased this product may leave a review.