FGFs Archives - Qkine Ltd

Recombinant zebrafish FGF-2, basic FGF (Qk002)

£250.00 – £400.00

Mature domain of zebrafish Danio rerio FGF2 (residues 2-154, Uniprot: B3DGE3) expressed in E.coli and purified to homogeneity as described in Ludwig et al. (2) Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa. Protein is provided in PBS without carrier protein at 10 mg/ml. Sequence: ATGGITTLPPAPDAENSSFPAGSFRDPKRLYCKNGGFFLRINADGRVDGARDKNDPHIRL QLQATAVGEVLIKGICTNRFLAMNADGRLFGTKRTTDECYFLERLESNNYNTYRSRKYPD WYVALKRTGQYKSGSKTSPGQKAILFLPMSAKC

View Cart

Select options / Details

Recombinant human FGF-2, basic FGF, 146 aa (Qk025)

£100.00 – £600.00

Mature domain of human FGF2 (residues 144-288, Uniprot: P09038) expressed in E.coli and purified to homogeneity. Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa. Protein is provided in PBS without carrier protein at 1.4 mg/ml.

View Cart

Select options / Details

Recombinant human FGF-4 (Qk004)

£160.00 – £1,200.00

Mature domain of human FGF4 (residues 79-206, Uniprot:P08620) expressed in E.coli and purified to homogeneity. Mature protein is a non-glycosylated protein with a molecular weight of ca. 14 kDa

View Cart

Select options / Details

Recombinant human FGF-10 (Qk003)

£160.00 – £1,200.00

Mature domain of human FGF10 (residues 64-208, Uniprot: O15520) expressed in E.coli and purified to homogeneity, non-glycosylated protein with a molecular weight of 17 kDa.