• FGF-2, basic FGF (zebrafish)

    £250.00£400.00
    Mature domain of zebrafish Danio rerio FGF2 (residues 2-154, Uniprot: B3DGE3) expressed in E.coli and purified to homogeneity as described in Ludwig et al. (2) Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa. Protein is provided in PBS without carrier protein at 10 mg/ml. Sequence: ATGGITTLPPAPDAENSSFPAGSFRDPKRLYCKNGGFFLRINADGRVDGARDKNDPHIRL QLQATAVGEVLIKGICTNRFLAMNADGRLFGTKRTTDECYFLERLESNNYNTYRSRKYPD WYVALKRTGQYKSGSKTSPGQKAILFLPMSAKC
  • FGF-2, basic FGF (human) 146 aa

    £100.00£600.00
    Mature domain of human FGF2 (residues 144-288, Uniprot: P09038) expressed in E.coli and purified to homogeneity.  Mature protein is a non-glycosylated protein with a molecular weight of ca. 17 kDa. Protein is provided in PBS without carrier protein at 1.4 mg/ml.
  • FGF-4 (human)

    £160.00£1,200.00
    Mature domain of human FGF4 (residues 79-206, Uniprot:P08620) expressed in E.coli and purified to homogeneity.  Mature protein is a non-glycosylated protein with a molecular weight of ca. 14 kDa